MYBPH Antibody - N-terminal region : HRP

MYBPH Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56598_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MYBPH binds to myosin; probably involved in interaction with thick myofilaments in the A-band.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYBPH

Key Reference: Welikson,R.E. J. Cell. Sci. 115 (PT 17), 3517-3526 (2002)

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Myosin-binding protein H

Protein Size: 477

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56598_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56598_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4608
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×