HSP65 Protein

Mycobacterium bovis BCG Recombinant HSP65 Protein
Artikelnummer
STRSPR-116A
Verpackungseinheit
50 µg
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: HSP65

Nature: Recombinant

Swiss-Prot: P0A521

Expression System: E. coli

Protein Length: Full Length

Amino Acid Sequence: MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWG APTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREG LRNVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLI AEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYI LLVSSKVSTVKDLLPLLEKVIGAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKA PGFGDRRKAMLQDMAILTGGQVISEEVGLTLENADLSLLGKARKVVVTKDETTIVEGA GDTDAIAGRVAQIRQEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKH RIEDAVRNAKAAVEEGIVAGGGVTLLQAAPTLDELKLEGDEATGANIVKVALEAPLKQ IAFNSGLEPGVVAEKVRNLPAGHGLNAQTGVYEDLLAAGVADPVKVTRSALQNAASIA GLFLTTEAVVADKPEKEKASVPGGGDMGGMDF

Purification: Multi-Step Purified

Purity: >90%

Storage Buffer: 20mM Tris/HCl, pH 7.5, 0.45M NaCl, 10% glycerol, 5mM bMe

Protein Size: ~65 kDa

Conjugate: No tag

Cellular Localization: Cytoplasm

Scientific Background: HSP65 isolated from Mycobacterium bovis BCG, is a member of the HSP60 family of heat shock proteins (2, 3). HSP60s are mitochondrial chaperonins that are typically held responsible for the transportation and refolding of proteins from the cytoplasm into the mitochondrial matrix. In addition to its role as a heat shock protein, HSP60 functions as a chaperonin to assist in folding linear amino acid chains into their respective three-dimensional structure. HSP60s are a ubiquitous class of HSPs that specifically promote the folding and assembly of cellular polypeptides in an ATP-dependent manner (1). Specifically, sequence comparison of HSP65 from different mycobacterium strains showed that the protein sequence of M. bovis BCG is identical to that of M. tuberculosis, and very similar to that of M. leprae, the pathogens that cause tuberculosis and tuberculoid leprosy, respectively (2,4). Mycobacterium bovis BCG HSP65 was identified as the immunodominant antigen during mycobacterial diseases and vaccination. It is also believed to be the antigen that induces autoimmune disease, such as adjuvant arthritis in rats (5, 6).

References: 1. Koll H., et al. (1992) Cell. 68: 1163-1175.2. Thole J.E.R., et al. (1985) Infect. Immuno. 50: 800-806.3. Thole J.E.R., et al., (1987) Infect. Immuno. 55: 1466-1475.4. Shinnick T.M. Sweetser D., Thole J., van Embden J. and Young R.A. (1987) Infect. Immuno. 55: 1932-1935.5. Van Eden W., et al. (1988) Nature 331: 171-178.6. Cobelens P.M., et al. (2002) Rheumatology 41: 775-779.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Mehr Informationen
Artikelnummer STRSPR-116A
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SPR-116A
Verpackungseinheit 50 µg
Mengeneinheit STK
Reaktivität Various species
Methode Western Blotting, ELISA, Functional Assay, SDS-PAGE
Produktinformation (PDF) Download
MSDS (PDF) Download