MYL4 Antibody - N-terminal region : HRP

MYL4 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56153_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYL4

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Myosin light chain 4

Protein Size: 197

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56153_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56153_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4635
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×