MYL6 Antibody - middle region : Biotin

MYL6 Antibody - middle region : Biotin
Artikelnummer
AVIARP57712_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYL6

Key Reference: Fu,Z.Y., (2006) Acta Biochim. Biophys. Sin. (Shanghai) 38 (9), 625-632

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myosin light polypeptide 6

Protein Size: 151

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57712_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57712_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 4637
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×