MYO1C Antibody - N-terminal region : HRP

MYO1C Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56292_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus. The nuclear isoform associates wi

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYO1C

Key Reference: Kahle,M., (2007) Histochem. Cell Biol. 127 (2), 139-148

Molecular Weight: 118kDa

Peptide Sequence: Synthetic peptide located within the following region: NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Unconventional myosin-Ic

Protein Size: 1028

Purification: Affinity Purified

Specificity#: isoform 1, 2 and 3
Mehr Informationen
Artikelnummer AVIARP56292_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56292_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4641
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×