MYO1E Antibody - middle region : FITC

MYO1E Antibody - middle region : FITC
Artikelnummer
AVIARP56601_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYO1E

Key Reference: Krendel,M., (2007) FEBS Lett. 581 (4), 644-650

Molecular Weight: 127kDa

Peptide Sequence: Synthetic peptide located within the following region: PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Unconventional myosin-Ie

Protein Size: 1108

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56601_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56601_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4643
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×