NAPE-PLD Antibody - N-terminal region : Biotin

NAPE-PLD Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55927_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: NAPE-PLD hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. NAPE-PLD is responsible for the generation of anandamide (N-arachidonoylethanolamine), the ligand of cannabinoid and vanilloid receptors

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NAPE-PLD

Key Reference: Egertova,M., (2008) J. Comp. Neurol. 506 (4), 604-615

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D

Protein Size: 393

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55927_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55927_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 222236
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×