NAPE-PLD Antibody - N-terminal region : HRP

NAPE-PLD Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55927_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NAPE-PLD hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. NAPE-PLD is responsible for the generation of anandamide (N-arachidonoylethanolamine), the ligand of cannabinoid and vanilloid receptors

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NAPE-PLD

Key Reference: Egertova,M., (2008) J. Comp. Neurol. 506 (4), 604-615

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D

Protein Size: 393

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55927_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55927_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 222236
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×