NASP Antibody - middle region : HRP

NASP Antibody - middle region : HRP
Artikelnummer
AVIARP57746_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene. The somatic form is expressed in all mitotic cells, is localize

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NASP

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nuclear autoantigenic sperm protein (Histone-binding) EMBL CAI22461.1

Protein Size: 449

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57746_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57746_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 4678
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×