NCDN Antibody - N-terminal region : FITC

NCDN Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54995_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes. Several alternatively

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCDN

Key Reference: Qiu,C., (2008) J. Biol. Chem. 283 (5), 2734-2740

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neurochondrin

Protein Size: 729

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54995_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54995_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23154
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×