NDOR1 Antibody - N-terminal region : FITC

NDOR1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56043_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an NADPH-dependent diflavin reductase that contains both flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) binding domains. The encoded protein is an enzyme that catalyzes the transfers electrons from NADPH through FAD and FMN cofactors to potential redox partners. Alternative splicing results in multiple transcript variants.

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: PPQGASLFLVSDQTTGRTPMPSPQLLVLFGSQTGTAQDVSERLGREARRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 412

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56043_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56043_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27158
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×