NDUFA9 Antibody - N-terminal region : HRP

NDUFA9 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56604_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NDUFA9

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

Protein Size: 377

Purification: Affinity Purified

Subunit: 9, mitochondrial
Mehr Informationen
Artikelnummer AVIARP56604_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56604_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4704
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×