NDUFC1 Antibody - middle region : FITC

NDUFC1 Antibody - middle region : FITC
Artikelnummer
AVIARP56360_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NDUFC1 is the accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The imme

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFC1

Key Reference: Loeffen,J.L., (1998) Biochem. Biophys. Res. Commun. 253 (2), 415-422

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial

Protein Size: 76

Purification: Affinity Purified

Subunit: C1, mitochondrial
Mehr Informationen
Artikelnummer AVIARP56360_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56360_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4717
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×