NDUFS3 Antibody - middle region : FITC

NDUFS3 Antibody - middle region : FITC
Artikelnummer
AVIARP56578_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFS3

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: ANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

Protein Size: 264

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56578_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56578_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4722
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×