NDUFS3 Antibody - middle region : HRP

NDUFS3 Antibody - middle region : HRP
Artikelnummer
AVIARP56579_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFS3

Key Reference: Vogel,R.O., (2007) J. Biol. Chem. 282 (10), 7582-7590

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

Protein Size: 264

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56579_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56579_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4722
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×