NDUFS4 Antibody - middle region

Description of Target: This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes.

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: FVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

Protein Size: 175

Purification: Affinity Purified

• Artikelnummer: AVIARP64291_P050-25
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP64291_P050-25UL
• Verpackungseinheit: 25µl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4724
• Wirt: Rabbit
• Konjugat: Unconjugated