Necap1 Antibody - N-terminal region : HRP

Necap1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55273_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Necap1 may be involved in endocytosis.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: RYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISKE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Adaptin ear-binding coat-associated protein 1

Protein Size: 275

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55273_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55273_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 67602
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×