NECAP2 Antibody - N-terminal region : FITC

NECAP2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57111_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NECAP2

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Adaptin ear-binding coat-associated protein 2

Protein Size: 263

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57111_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57111_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55707
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×