NEGR1 Antibody - N-terminal region : FITC

NEGR1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55701_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NEGR1 may be involved in cell-adhesion. NEGR1 may function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NEGR1

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neuronal growth regulator 1

Protein Size: 354

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55701_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55701_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 257194
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×