NEGR1 Antibody - N-terminal region : HRP

NEGR1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55701_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NEGR1 may be involved in cell-adhesion. NEGR1 may function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NEGR1

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Neuronal growth regulator 1

Protein Size: 354

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55701_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55701_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 257194
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×