NHLH1 Antibody - middle region : Biotin

NHLH1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57876_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: NHLH1 may serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NHLH1

Key Reference: Manetopoulos,C., (2003) Biochem. Biophys. Res. Commun. 307 (4), 891-899

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: AKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Helix-loop-helix protein 1

Protein Size: 133

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57876_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57876_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4807
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×