NHLRC2 Antibody - N-terminal region : FITC

NHLRC2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55889_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NHLRC2

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NHL repeat-containing protein 2

Protein Size: 726

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55889_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55889_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 374354
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×