NIT1 Antibody - N-terminal region : FITC

NIT1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56646_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tum

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NIT1

Key Reference: Semba,S., (2006) J. Biol. Chem. 281 (38), 28244-28253

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nitrilase homolog 1

Protein Size: 327

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56646_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56646_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4817
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×