NIT1 Antibody - N-terminal region : HRP

NIT1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56647_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tum

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NIT1

Key Reference: Semba,S., (2006) J. Biol. Chem. 281 (38), 28244-28253

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nitrilase homolog 1

Protein Size: 327

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56647_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56647_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4817
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×