NKAPD1 Antibody - middle region : FITC

NKAPD1 Antibody - middle region : FITC
Artikelnummer
AVIARP57143_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf57

Key Reference: 0

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: RWGHSGYKELYPEEFETDSSDQQDITNGKKTSPQVKSSTHESRKHKKSKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: uncharacterized protein NKAPD1

Protein Size: 293

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57143_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57143_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55216
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×