NKIRAS1 Antibody - N-terminal region : FITC

NKIRAS1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55370_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NKIRAS1

Key Reference: Adams,M.D., (er) Ann. Rheum. Dis. (2008) In press

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NF-kappa-B inhibitor-interacting Ras-like protein 1

Protein Size: 192

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55370_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55370_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 28512
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×