NKIRAS2 Antibody - C-terminal region : Biotin

NKIRAS2 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54370_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NKIRAS2

Key Reference: Fenwick,C., (er) Ann. Rheum. Dis. (2008) In press

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: VKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NF-kappa-B inhibitor-interacting Ras-like protein 2

Protein Size: 191

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54370_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54370_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 28511
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×