NKIRAS2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NKIRAS2

Key Reference: Munday,M.R., (er) Ann. Rheum. Dis. (2008) In press

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NF-kappa-B inhibitor-interacting Ras-like protein 2

Protein Size: 191

Purification: Affinity Purified

• Artikelnummer: AVIARP54369_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54369_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 28511
• Wirt: Rabbit
• Konjugat: Conjugated, HRP