NKX3-2 Antibody - middle region : Biotin

NKX3-2 Antibody - middle region : Biotin
Artikelnummer
AVIARP58064_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: NKX3-2 is a member of the NK family of homeobox-containing proteins. It may play a role in skeletal development.This gene encodes a member of the NK family of homeobox-containing proteins. The encoded protein may play a role in skeletal development. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1111 BC111966.1 1-1111 1112-2241 AC006445.11 110916-112045

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NKX3-2

Key Reference: Rodrigo,I., (2004) Mol. Cell. Biol. 24 (7), 2757-2766

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: GAGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeobox protein Nkx-3.2

Protein Size: 333

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58064_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58064_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 579
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×