NLRP1 Antibody : FITC

NLRP1 Antibody : FITC
Artikelnummer
AVIARP54479_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like motif, which is possibly involved in protein-protein interactions. This protein interacts strongly with caspase 2 and weakly with caspase 9. Overexpression of this gene was demonstrated to induce apoptosis in cells. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence AAEGIWQKKTLFSPDDLRKHGLDGAIISTFLKMGILQEHPIPLSYSFIHL

Molecular Weight: 166 kDa

Peptide Sequence: Synthetic peptide located within the following region: AAEGIWQKKTLFSPDDLRKHGLDGAIISTFLKMGILQEHPIPLSYSFIHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NACHT, LRR and PYD domains-containing protein 1

Protein Size: 1473

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54479_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54479_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Human Gene ID 22861
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×