NLRP1 Antibody - N-terminal region : FITC

NLRP1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54478_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP1

Key Reference: Fahy,R.J., (2008) Am. J. Respir. Crit. Care Med. 177 (9), 983-988

Molecular Weight: 155kDa

Peptide Sequence: Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NACHT, LRR and PYD domains-containing protein 1

Protein Size: 1375

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54478_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54478_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22861
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×