NME4 Antibody - middle region : Biotin

NME4 Antibody - middle region : Biotin
Artikelnummer
AVIARP56611_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm2

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NME4

Key Reference: Martin,J., (2004) Nature 432 (7020), 988-994

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleoside diphosphate kinase, mitochondrial

Protein Size: 187

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56611_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56611_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4833
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×