NME4 Antibody - middle region : HRP

NME4 Antibody - middle region : HRP
Artikelnummer
AVIARP56611_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm2

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NME4

Key Reference: Martin,J., (2004) Nature 432 (7020), 988-994

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nucleoside diphosphate kinase, mitochondrial

Protein Size: 187

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56611_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56611_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4833
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×