NOB1 Antibody - N-terminal region : HRP

NOB1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54975_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NOB1 may play a role in mRNA degradation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NOB1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: RNA-binding protein NOB1

Protein Size: 412

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54975_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54975_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 28987
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×