NODAL Antibody - middle region : FITC

NODAL Antibody - middle region : FITC
Artikelnummer
AVIARP57100_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NODAL

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nodal homolog

Protein Size: 347

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57100_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57100_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4838
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×