NOLA3 Antibody - middle region : Biotin

NOLA3 Antibody - middle region : Biotin
Artikelnummer
AVIARP57279_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOLA3

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: H/ACA ribonucleoprotein complex subunit 3

Protein Size: 64

Purification: Affinity Purified

Subunit: 3
Mehr Informationen
Artikelnummer AVIARP57279_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57279_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55505
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×