NOSIP Antibody - middle region : HRP

NOSIP Antibody - middle region : HRP
Artikelnummer
AVIARP56785_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NOSIP negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOSIP

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: VEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nitric oxide synthase-interacting protein

Protein Size: 301

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56785_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56785_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51070
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×