NPM2 Antibody - N-terminal region : FITC

NPM2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58310_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NPM2 is a core histones chaperone involved in chromatin reprogramming, specially during fertilization and early embryonic development. It probably involved in sperm DNA decondensation during fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPM2

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTIC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleoplasmin-2

Protein Size: 214

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58310_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58310_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10361
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×