NRARP Antibody - middle region : HRP

NRARP Antibody - middle region : HRP
Artikelnummer
AVIARP56166_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NRARP may play a role in the formation of somites.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRARP

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Notch-regulated ankyrin repeat-containing protein

Protein Size: 114

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56166_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56166_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 441478
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×