NRBP1 Antibody - C-terminal region : HRP

NRBP1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54950_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human NRBP1

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: nuclear receptor-binding protein

Protein Size: 543

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54950_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54950_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29959
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×