NRL Antibody - C-terminal region : HRP

NRL Antibody - C-terminal region : HRP
Artikelnummer
AVIARP58167_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a basic motif-leucine zipper transcription factor of the Maf subfamily. The encoded protein is conserved among vertebrates and is a critical intrinsic regulator of photoceptor development and function. Mutations in this gene have been associated with retinitis pigmentosa and retinal degenerative diseases.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NRL

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Neural retina-specific leucine zipper protein

Protein Size: 237

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58167_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58167_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4901
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×