NSMCE3 Antibody - middle region : FITC

NSMCE3 Antibody - middle region : FITC
Artikelnummer
AVIARP57727_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is part of the SMC5-6 chromatin reorganizing complex and is a member of the MAGE superfamily. This is an intronless gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDNL2

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: non-structural maintenance of chromosomes element 3 homolog

Protein Size: 304

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57727_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57727_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56160
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×