NT5DC1 Antibody - N-terminal region : Biotin

NT5DC1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55511_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of NT5DC1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NT5DC1

Key Reference: Wan,D., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'-nucleotidase domain-containing protein 1

Protein Size: 455

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55511_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55511_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221294
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×