NT5M Antibody - N-terminal region : Biotin

NT5M Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57370_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NT5M

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'(3')-deoxyribonucleotidase, mitochondrial

Protein Size: 228

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57370_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57370_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56953
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×