NUBP1 Antibody - N-terminal region : Biotin

NUBP1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56355_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al., 1999 [PubMed 10486206]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NUBP1

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic Fe-S cluster assembly factor NUBP1

Protein Size: 320

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56355_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56355_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4682
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×