NUCB1 Antibody - C-terminal region

Description of Target: Nucleobindin, also known as calnuc, participates in Ca2+ storage in the Golgi, as well as in other biological processes that involve DNA-binding and protein-protein interactions.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NUCB1

Key Reference: de Alba,E. et al., (2004) Biochemistry 43 (31), 10039-10049

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: Nucleobindin-1

Protein Size: 461

Purification: Affinity Purified

• Artikelnummer: AVIP102230_P050-25
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: P102230_P050-25UL
• Verpackungseinheit: 25µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4924
• Wirt: Rabbit
• Konjugat: Unconjugated