NUDCD3 Antibody - middle region : Biotin

NUDCD3 Antibody - middle region : Biotin
Artikelnummer
AVIARP55233_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUDCD3

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NudC domain-containing protein 3

Protein Size: 361

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55233_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55233_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23386
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×