NUDCD3 Antibody - middle region : HRP

NUDCD3 Antibody - middle region : HRP
Artikelnummer
AVIARP55233_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUDCD3

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NudC domain-containing protein 3

Protein Size: 361

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55233_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55233_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23386
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×