NXPH4 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NXPH4 may be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NXPH4

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neurexophilin-4

Protein Size: 308

Purification: Affinity Purified

• Artikelnummer: AVIARP53543_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53543_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11247
• Wirt: Rabbit
• Konjugat: Conjugated, FITC