OAZ2 Antibody - middle region : FITC

OAZ2 Antibody - middle region : FITC
Artikelnummer
AVIARP56372_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis. The ornithine decarboxylase antizymes play a role in the regulation of polyamine synthesis by binding to

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OAZ2

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ornithine decarboxylase antizyme 2

Protein Size: 189

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56372_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56372_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4947
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×